Godlike Productions - Discussion Forum
Users Online Now: 2,088 (Who's On?)Visitors Today: 1,705,774
Pageviews Today: 2,359,668Threads Today: 585Posts Today: 10,855
06:20 PM


Rate this Thread

Absolute BS Crap Reasonable Nice Amazing
 

7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’

 
Truthache

User ID: 1465537
United States
04/23/2012 07:25 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
They have been steadily closing off cave access to the general public throughout America for a couple of years now.

It is claimed to be the response to this bat problem.

But then I wonder if there isn't another reason why they would want to keep people from reaching caves these days.
in warm pursuit...
Anonymous Coward
User ID: 14719344
United States
04/23/2012 07:28 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Soon us
verysad
Anonymous Coward
User ID: 11146721
United States
04/23/2012 07:30 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Consequences of much-reduced or extinct bat population:

The past two decades have seen an increasing number of virulent infectious diseases in natural populations and managed landscapes. In both animals and plants, an unprecedented number of fungal and fungal-like diseases have recently caused some of the most severe die-offs and extinctions ever witnessed in wild species, and are jeopardizing food security.

[link to www.nature.com]

Fewer bats = more insects = less food for humans = more blood-borne insect-passaged diseases in human...

[link to www.nature.com]

[link to www.nature.com]

Net result: fewer bats = fewer humans; sick bats = sick humans.

[link to wwwnc.cdc.gov]

[link to wwwnc.cdc.gov]

It is a matter of time until humans begin dying from some form of white-spot fungus...

The same white-spot-syndrome occurs in shrimp:

gi|17158139|ref|NP_477557.1| TTGERVVKECSVHTSIVVLTDDGGWQCRPKYPTYFGGSGGTSMTACAFNPSTHKGPPPPS

gi|380040682|gb|AFD32872.1| ----RVL----------IQLGKQEIDFSPAFKIYLSTR----------------------

**: : . : * : *:.

gi|17158139|ref|NP_477557.1| SSTPIYYDVLKKQQIRNHTEFRNSSYISKLRQSSSLAEFKIKCNDPEFLYKNPITCFCNN

gi|380040682|gb|AFD32872.1| --------------------------------------------DPSA------------

**.

gi|17158139|ref|NP_477557.1| KKDVLNNDLLSQDVTKDMKFRGMYECMENPCVMMPNI--DPSFVTFDVSTMKCVP-GVNN

gi|380040682|gb|AFD32872.1| -------------------------------TFAPDICSRTTFVNFTVTQSSLQTQSLNE

.: *:* :**.* *: . .:*:

gi|17158139|ref|NP_477557.1| PQDSNRHAIIGDDRTPLVGTVPAMGIFLADQSKRGDQIHQQRPKSSIDETTAKKIALAQA

gi|380040682|gb|AFD32872.1| VLKSER-PDVDERRSNLIKLQGEFKVHLRQLEKR--------------------------

.*:* : : *: *: : :.* : .**

Seems related to a Platypus gene:

>ref|NP_477557.1| wsv035 [Shrimp white spot syndrome virus]
gb|AAK77710.1|AF369029_41 ORF41 [shrimp white spot syndrome virus]
gb|AAL33039.1| wsv035 [shrimp white spot syndrome virus]
gb|AAL88960.1| WSSV092 [shrimp white spot syndrome virus]
gb|AAW88444.1| envelope protein [Shrimp white spot syndrome virus]
Length=972

GENE ID: 926772 Swssvgp035 | wsv035 [Shrimp white spot syndrome virus]
(10 or fewer PubMed links)

Score = 54.9 bits (122), Expect = 6e-08
Identities = 15/15 (100%), Positives = 15/15 (100%), Gaps = 0/15 (0%)

Query 1 VMMPNIDPSFVTFDV 15
VMMPNIDPSFVTFDV
Sbjct 452 VMMPNIDPSFVTFDV 466


>ref|XP_003430885.1| PREDICTED: LOW QUALITY PROTEIN: FRAS1-related extracellular matrix
protein 2-like [Ornithorhynchus anatinus]
Length=2938

GENE ID: 100081675 LOC100081675 | FRAS1-related extracellular matrix protein
2-like [Ornithorhynchus anatinus]

Score = 32.9 bits (70), Expect = 1.3
Identities = 11/18 (61%), Positives = 11/18 (61%), Gaps = 5/18 (28%)

Query 1 VMM-----PNIDPSFVTF 13
VMM PNID S VTF
Sbjct 1939 VMMDFEERPNIDHSIVTF 1956


>ref|YP_526072.1| unnamed protein product [Saccharophagus degradans 2-40]
gb|ABD79860.1| hypothetical protein Sde_0596 [Saccharophagus degradans 2-40]
Length=606

GENE ID: 3965003 Sde_0596 | corrinoid adenosyltransferase BtuR/CobO/CobP
[Saccharophagus degradans 2-40] (10 or fewer PubMed links)

Score = 31.2 bits (66), Expect = 4.3
Identities = 8/8 (100%), Positives = 8/8 (100%), Gaps = 0/8 (0%)

Query 3 MPNIDPSF 10
MPNIDPSF
Sbjct 252 MPNIDPSF 259

Also related to Saccharophagus degradans.

Seems the bats infected cave shrimp or, perhaps, shrimp infected cave bats...

[link to books.google.com]
Anonymous Coward
User ID: 11889552
United Kingdom
04/23/2012 07:34 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
This is it. 32 more days till the return of Christ and the Kingdom of God.
 Quoting: 777 7078293


why such a specific date? and i'm afraid there will be no rapture.we have all sat back and let meglomaniacs run the planet,poison the oceans,air,food,evverything,while we argue pointless arguments over who's religion is the truest one.while calling others daemons.we deserve extinction.
Anonymous Coward
User ID: 1353340
United States
04/23/2012 07:38 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
sucks..the bugs are already gonna be out of control this summer cause the mild winter. kinda puts the *pest* in pestilence.
MK_Ultra

User ID: 14889867
United States
04/23/2012 07:47 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
I hope you all realize that before long HOMO SAPIENS are going to be on the list in large numbers.

We cannot let the death machine continue to poison the planet in the name of short term profits.

Sanity must be restored or we will destroy ourselves.
Nothing is exactly as it seems, nor is it otherwise.

Everything is more beautiful because we're doomed.
Anonymous Coward
User ID: 13944478
United States
04/23/2012 07:49 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
sucks..the bugs are already gonna be out of control this summer cause the mild winter. kinda puts the *pest* in pestilence.
 Quoting: Anonymous Coward 1353340


and with bill gates releasing those gmo mosquitos here in florida...break out the SKIN SO SOFT avon oil.
to keep the bugger away.

eucalyptus trees that grow in UR yard will repel mosquitos and other insects.these trees need lots of water to grow.
TheTruthWorker

User ID: 14354297
United States
04/23/2012 07:56 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
This is it. 32 more days till the return of Christ and the Kingdom of God.
 Quoting: 777 7078293


That you Terral?
Anonymous Coward
User ID: 13691415
United States
04/23/2012 07:59 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Soon us
verysad
 Quoting: Goofy for God


YUP!!!

:cross71:

:HopeIsInLord:
Anonymous Coward
User ID: 1406613
Australia
04/23/2012 08:28 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Send a few to Aus they are in plague proportions here so much so they blacken the sky in some areas not to mention shitting over everything.
 Quoting: khnum 455005


i found this more scary after i got link to this site :
[link to www.end-times-prophecy.org]
 Quoting: SteppingoutofMatrix


Interesting website
saved

User ID: 699706
United States
04/23/2012 08:28 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
This shit has been happening since the beginning of time. Don't believe the HYPE!
 Quoting: Anonymous Coward 9663607


Hype?? wHAT A SHIT FOR BRAINS!
Come And Take It!
Anonymous Coward
User ID: 14719722
Ireland
04/23/2012 08:33 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
...and strange trumpeting and booming sounds are being heard all over the world...
 Quoting: Anonymous Coward 13297298


That's another things that creeps the s***t out of me , so many abnormal events , that makes you wonder.... what's next? hiding
 Quoting: SteppingoutofMatrix


Robert Schoch theory is that it is from the sun. CME ejections etc hitting the earth, building up and the noises
are the built up energy releasing.
Ozark

User ID: 9696387
United States
04/23/2012 08:51 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
sucks..the bugs are already gonna be out of control this summer cause the mild winter. kinda puts the *pest* in pestilence.
 Quoting: Anonymous Coward 1353340


and with bill gates releasing those gmo mosquitos here in florida...break out the SKIN SO SOFT avon oil.
to keep the bugger away.

eucalyptus trees that grow in UR yard will repel mosquitos and other insects.these trees need lots of water to grow.
 Quoting: Anonymous Coward 13944478



And you can put a bat house in your yard, they eat mosquitos and other insects. Then you can sit outside and enjoying watching the bats in the evening!

We have 8-9 different bat species here and a very large population of bats that nest in trees and caves. We put up our first bat house yesterday!!! We have almost no mosquitos, never have to put repellant on.

IMHO, it is GMO's, agricultural spraying, chemtrails and oil related toxins.

Love bats!!!

bat
Favorite quote or Haiku,
Nikos Kazantzakis

" I said to the Almond tree, "Sister, speak to me of God..."
And the Almond tree blossomed...
Anonymous Coward
User ID: 4701453
United States
04/23/2012 08:51 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
List of Mass Animal Deaths 2012

19th April 2012 - Thousands of Fish, also Cows and Dogs killed in Pakistan.

18th April 2012 - Hundreds of dead Fish, Tortoises, Turtles and several other animals dead in Pakistan.

17th April 2012 - Thousands of fish (30 species) dead in a creek in Tennesse.

17th April 2012 - Thousands of fish continue to turn up dead in the Zandvlei Estuary in South Africa.

17th April 2012 - Several thousand Fish found dead in River in India.

17th April 2012 - Thousands of Dead Fish found floating in Pond in India.

13th April 2012 - Mass Bees falling dead in Canyon Country California.

13th April 2012 - Hundreds of dead Fish litter Ocean Floor in Durban South Africa.

11th April 2012 - 300 more Dolphins found dead on beaches in Peru.

11th April 2012 - 14,000 Fish dead in Creek in Missouri.

9th April 2012 - Thousands of fish found dead in Lake in India.

9th April 2012 - 3 Whales wash up dead in India.

6th April 2012 - Over 50 Turtles wash ashore dead in India.

6th April 2012 - Thousands of Dead Fish found in waterway in Malaysia.

5th April 2012 - Thousands of Dead Fish found floating in Ganga river in India.

4th April 2012 - 615 Dolphins Found Dead on Beaches in Peru.

4th April 2012 - Over 100 Dead Catfish found in Boyne River Australia.

3rd April 2012 - Thousands of Dolphins are dying in Gulf of Mexico.

1st April 2012 - 9,000 Livestock killed by Foot and Mouth Disease in Egypt.

1st April 2012 - 3,000 Dolphins have washed up dead this year in Peru.

30th March 2012 - Hundreds of Birds Killed in Hail storm in Texas. Link

20th March 2012 - Thousands of dead Fish wash up on riverbank in Singapore.

20th March 2012 - Thousands of dead Fish found in River in Minnesota.

17th March 2012 - 4 beached Whales die in East China. Link

13th March 2012 - 5,000 Fish found dead in a lake in Malaysia.

12th March 2012 - Disease Kills 170 Chickens in South Africa.

9th March 2012 - Dozens of birds drop dead in University grounds in Florida.

8th March 2012 - 34 Dolphins wash up dead along coast in Texas.

4th March 2012 - 400 Grey Seals found dead off Cape Breton in Australia.

3rd March 2012 - Many Little Penguins Dying in Perth, Australia.

2nd March 2012 - Thousands of Jellyfish wash ashore in Texas.

1st March 2012 - 800kg dead fish found in Cyprus.

NOTE: During 2011 - Record number (335) of Sea Otters either found dead or ill along California coast in America.

28th February 2012 - Over 20,000 Chickens dead in Dharke in Nepal.

27th February 2012 - Thousands of fish found dead at nature reserve in UK.


25th February 2012 - 60 Gulls found dead in New Zealand.


21st February 2012 - 3,000 Tuna Fish found dead off coast of Dubai.

21st February 2012 - 25 Rare Turtles wash up dead in Bangladesh.


18th February 2012 - Thousands of Lambs being killed by incurable virus in the UK.

16th February 2012 - Tonnes of dead Fish wash ashore in Somalia.

15th February 2012 - 100 dead birds found along highway in Maryland America.

14th February 2012 - UPDATE: 124 Dolphins have now beached and died in Cape Cod America.


9th February 2012 - Over 200 Dolphins wash up dead in Peru.

9th February 2012 - 800 dead Birds found in Christchurch New Zealand.

7th February 2012 - Dozens of dead Birds found on beach in Florida.

6th February 2012 - Tens of Thousands of Birds to be "culled" due to H5N1 virus in Nepal and India.

3rd February 2012 - Thousands of Fish wash up dead in Nigeria.

3rd February 2012 - 100 Pigeons found dead in South Dakota.

3rd February 2012 - 1,000 Fish found dead floating in two ponds in Virginia.

31st January 2012 - Massive Fish death in Philippines.

27th January 2012 - 64 Dolphins and Porpoises found dead along the Atlantic Coast.

27th January 2012 - 10,000 Fish found dead in Japan.

27th January 2012 - 12 Dolphins wash up dead in Louisiana.

27th January 2012 - 10,000 Ducks to be Killed in Australia.

24th January 2012 - 5,000 Fish found dead in Perth's River in Australia.

UPDATE: 85 Dolphins beached, 61 dead in Cape Cod in America.

24th January 2012 - 82 Whales dead in New Zealand.

22nd January 2012 - Hundreds of dead Birds found in India.

21st January 2012 - 4 Whales found dead on beach in New Zealand.

19th January 2012 - 20,000 Birds killed by oil spill in New Zealand.

19th January 2012 - 3 TONNES of dead Fish wash ashore in Somalia.

NOTE: During the past 6 years, 6.7 MILLION Bats have died from White Nose Disease in America.

16th January 2012 - 53 Fur Seals found dead on Beach in Australia.

14th January 2012 - 30 Dolphins beach, 20 dead in Cape Cod in America.

11th January 2012 - Hundreds of dead Fish wash ashore in The Bahamas.

10th January 2012 - 2000 Chickens dead in India.

10th January 2012 - Large number of dead fish found floating across 3km of river in China.

9th January 2012 - Hundreds of Wildlife Animals found dead in Zimbabwe.

9th January 2012 - Dozens of Turtles found dead in Florida.

8th January 2012 - Thousands of Deer have died during past few months in Northern Plains in America.

7th January 2012 - Thousands of Dead Fish found floating in the Gholani River in India.

7th January 2012 - 7 Whales become stranded and die in New Zealand.

7th January 2012 - Thousands of Fish found dead in California.

5th January 2012 - 3000 Dead Fish in Ghana.

4th January 2012 - Oil soaked birds washing up dead on Western Isles of Scotland.

2nd January 2012 - 20 TONNES of Fish wash up dead on beach in Norway.

1st January 2012 - 200 Blackbirds found dead in Arkansas USA.

And that's just in 2012 so far , not considering 2011 and 2010
 Quoting: SteppingoutofMatrix


The reset button will be pressed in 3...2...1...
Epic Beard Guy

User ID: 1554083
United States
04/23/2012 08:54 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
They have been steadily closing off cave access to the general public throughout America for a couple of years now.

It is claimed to be the response to this bat problem.

But then I wonder if there isn't another reason why they would want to keep people from reaching caves these days.
 Quoting: Truthache


Why would anyone want to go underground? They might miss the big population control die-off the powers that be have planned for us. If it is Solar doom, disease doom, economic doom, or almost any other doom, being underground might make you miss it.
Hope for the best, but prepare for the worst.
"America is at that awkward stage. It's too late to work within the system, but too early to shoot the bastards." -- Claire Wolfe
Anonymous Coward
User ID: 8437259
United States
04/23/2012 08:56 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
List of Mass Animal Deaths 2012

19th April 2012 - Thousands of Fish, also Cows and Dogs killed in Pakistan.

18th April 2012 - Hundreds of dead Fish, Tortoises, Turtles and several other animals dead in Pakistan.

17th April 2012 - Thousands of fish (30 species) dead in a creek in Tennesse.

17th April 2012 - Thousands of fish continue to turn up dead in the Zandvlei Estuary in South Africa.

17th April 2012 - Several thousand Fish found dead in River in India.

17th April 2012 - Thousands of Dead Fish found floating in Pond in India.

13th April 2012 - Mass Bees falling dead in Canyon Country California.

13th April 2012 - Hundreds of dead Fish litter Ocean Floor in Durban South Africa.

11th April 2012 - 300 more Dolphins found dead on beaches in Peru.

11th April 2012 - 14,000 Fish dead in Creek in Missouri.

9th April 2012 - Thousands of fish found dead in Lake in India.

9th April 2012 - 3 Whales wash up dead in India.

6th April 2012 - Over 50 Turtles wash ashore dead in India.

6th April 2012 - Thousands of Dead Fish found in waterway in Malaysia.

5th April 2012 - Thousands of Dead Fish found floating in Ganga river in India.

4th April 2012 - 615 Dolphins Found Dead on Beaches in Peru.

4th April 2012 - Over 100 Dead Catfish found in Boyne River Australia.

3rd April 2012 - Thousands of Dolphins are dying in Gulf of Mexico.

1st April 2012 - 9,000 Livestock killed by Foot and Mouth Disease in Egypt.

1st April 2012 - 3,000 Dolphins have washed up dead this year in Peru.

30th March 2012 - Hundreds of Birds Killed in Hail storm in Texas. Link

20th March 2012 - Thousands of dead Fish wash up on riverbank in Singapore.

20th March 2012 - Thousands of dead Fish found in River in Minnesota.

17th March 2012 - 4 beached Whales die in East China. Link

13th March 2012 - 5,000 Fish found dead in a lake in Malaysia.

12th March 2012 - Disease Kills 170 Chickens in South Africa.

9th March 2012 - Dozens of birds drop dead in University grounds in Florida.

8th March 2012 - 34 Dolphins wash up dead along coast in Texas.

4th March 2012 - 400 Grey Seals found dead off Cape Breton in Australia.

3rd March 2012 - Many Little Penguins Dying in Perth, Australia.

2nd March 2012 - Thousands of Jellyfish wash ashore in Texas.

1st March 2012 - 800kg dead fish found in Cyprus.

NOTE: During 2011 - Record number (335) of Sea Otters either found dead or ill along California coast in America.

28th February 2012 - Over 20,000 Chickens dead in Dharke in Nepal.

27th February 2012 - Thousands of fish found dead at nature reserve in UK.


25th February 2012 - 60 Gulls found dead in New Zealand.


21st February 2012 - 3,000 Tuna Fish found dead off coast of Dubai.

21st February 2012 - 25 Rare Turtles wash up dead in Bangladesh.


18th February 2012 - Thousands of Lambs being killed by incurable virus in the UK.

16th February 2012 - Tonnes of dead Fish wash ashore in Somalia.

15th February 2012 - 100 dead birds found along highway in Maryland America.

14th February 2012 - UPDATE: 124 Dolphins have now beached and died in Cape Cod America.


9th February 2012 - Over 200 Dolphins wash up dead in Peru.

9th February 2012 - 800 dead Birds found in Christchurch New Zealand.

7th February 2012 - Dozens of dead Birds found on beach in Florida.

6th February 2012 - Tens of Thousands of Birds to be "culled" due to H5N1 virus in Nepal and India.

3rd February 2012 - Thousands of Fish wash up dead in Nigeria.

3rd February 2012 - 100 Pigeons found dead in South Dakota.

3rd February 2012 - 1,000 Fish found dead floating in two ponds in Virginia.

31st January 2012 - Massive Fish death in Philippines.

27th January 2012 - 64 Dolphins and Porpoises found dead along the Atlantic Coast.

27th January 2012 - 10,000 Fish found dead in Japan.

27th January 2012 - 12 Dolphins wash up dead in Louisiana.

27th January 2012 - 10,000 Ducks to be Killed in Australia.

24th January 2012 - 5,000 Fish found dead in Perth's River in Australia.

UPDATE: 85 Dolphins beached, 61 dead in Cape Cod in America.

24th January 2012 - 82 Whales dead in New Zealand.

22nd January 2012 - Hundreds of dead Birds found in India.

21st January 2012 - 4 Whales found dead on beach in New Zealand.

19th January 2012 - 20,000 Birds killed by oil spill in New Zealand.

19th January 2012 - 3 TONNES of dead Fish wash ashore in Somalia.

NOTE: During the past 6 years, 6.7 MILLION Bats have died from White Nose Disease in America.

16th January 2012 - 53 Fur Seals found dead on Beach in Australia.

14th January 2012 - 30 Dolphins beach, 20 dead in Cape Cod in America.

11th January 2012 - Hundreds of dead Fish wash ashore in The Bahamas.

10th January 2012 - 2000 Chickens dead in India.

10th January 2012 - Large number of dead fish found floating across 3km of river in China.

9th January 2012 - Hundreds of Wildlife Animals found dead in Zimbabwe.

9th January 2012 - Dozens of Turtles found dead in Florida.

8th January 2012 - Thousands of Deer have died during past few months in Northern Plains in America.

7th January 2012 - Thousands of Dead Fish found floating in the Gholani River in India.

7th January 2012 - 7 Whales become stranded and die in New Zealand.

7th January 2012 - Thousands of Fish found dead in California.

5th January 2012 - 3000 Dead Fish in Ghana.

4th January 2012 - Oil soaked birds washing up dead on Western Isles of Scotland.

2nd January 2012 - 20 TONNES of Fish wash up dead on beach in Norway.

1st January 2012 - 200 Blackbirds found dead in Arkansas USA.

And that's just in 2012 so far , not considering 2011 and 2010
 Quoting: SteppingoutofMatrix

Let's add to this:
10th April 2012 Disease that killed seals and Walrus in Alaska now found in the Polar Bears <<USGS yet to explain.
[link to www.livescience.com]

 Quoting: citizenperth
Pa resident1

User ID: 12833645
United States
04/23/2012 09:04 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
[link to www.youtube.com]
Over 7 million bats have been wiped out by a disease (WNS) that is rapidly spreading across the country. It’s an extinction of animals by disease that has no precedent in recorded history. First identified in the northeastern United States, WNS has wiped out an estimated 95% of Pennsylvania’s bat population and is quickly spreading across the country. It was most recently discovered in Missouri, Delaware and Alabama. “This is like bringing small pox to the New World. It is surely an unprecedented wildlife disaster for North America,” said Bucknell University professor Dr. DeeAnn Reeder. Reeder is one of the country’s leading experts on WNS, and one of the researchers responsible for identifying the cause of the disease in 2011. “We can’t stop this thing. It’s marching across the country and we’re going to see some extinction.”
 Quoting: SteppingoutofMatrix


Sad.

This explains why I have not seen as many bats flying around at dusk in the past few years.
"When you don't keep your word, you lose credibility and trustworthy friends"
Timetraveler

User ID: 1605109
United States
04/23/2012 09:07 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Hold the phone here!
Good news on the bats.....
Thread: Good News! Bats rebound after WNS decease scare in NYS caves
what time is it now?
Pa resident1

User ID: 12833645
United States
04/23/2012 09:09 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
sucks..the bugs are already gonna be out of control this summer cause the mild winter. kinda puts the *pest* in pestilence.
 Quoting: Anonymous Coward 1353340


and with bill gates releasing those gmo mosquitos here in florida...break out the SKIN SO SOFT avon oil.
to keep the bugger away.

eucalyptus trees that grow in UR yard will repel mosquitos and other insects.these trees need lots of water to grow.
 Quoting: Anonymous Coward 13944478



And you can put a bat house in your yard, they eat mosquitos and other insects. Then you can sit outside and enjoying watching the bats in the evening!

We have 8-9 different bat species here and a very large population of bats that nest in trees and caves. We put up our first bat house yesterday!!! We have almost no mosquitos, never have to put repellant on.

IMHO, it is GMO's, agricultural spraying, chemtrails and oil related toxins.
Love bats!!!

bat
 Quoting: Ozark


I agree.

A lady that is buying the farm next to me got permission to put her bee hive on the property last year while they had a contract on the property. Any how, the owners that are selling the property told her they wanted to plant corn on it. What she didn't know, is that they planned on no-tilling it (no-till - spraying the ground with a very powerful herbicide then drilling the corn). Her hive did well for a few months there till after the corn was no-tilled. Not long after the ground was no-tilled, the bees began dropping dead in groups and in several weeks ALL bees were dead. The no-till was used approximately 150 feet near the hives at the closest to the hive. So thus the herbicides DO kill bees!!!

verysad

Last Edited by Pa resident1 on 04/23/2012 09:11 AM
"When you don't keep your word, you lose credibility and trustworthy friends"
Doom_Sayer

User ID: 11439906
United States
04/23/2012 09:21 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Does anyone have the link to the noises? I want to hear them.

They may be the sounds of trumpets mentioned in the Necronomicon, the Egyptian book of the dead, and there was another book I was reading a long time ago I can't remember the name of the book but the chapter was "How to summon demons" which had a spell in it that stated when the spell is finished the trumpets will call.

Reading them for research.. no I did not call any demons. But I've seen many of them and they do exist. Do I have proof? no.

But I did have a foot print in coffee grinds that were spilled in two sides of the room and the can was standing up on the counter after using a Ouija board.

The footprint was the size of a babies foot with 3 toes.
dying planet
User ID: 10444427
United States
04/23/2012 09:27 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Yes, this is the great shaking of the earth that was foretold to come by many ancient civilizations who had no knowledge of each other in most cases.
The curtain is closing, slowly but surely, and those caught up in the materialism and greed, hate, and total indifference are choosing where they will be residing.
That place will be a literal HELL....make no mistake folks, it will be a hell that they themselves choose.
Why do you think there are so many drug, food, porn, alcoholics, gamblers....any addicts i may have left out, you get the picture.....its because they don't listen to THEIR CONSCIENCE who is trying to tell them to repent (turn back) to re-spect(look and analyze at detail)and they CHOOSE not to do so out of FEAR.
Fear is lodged very deep into their consciousness.How did that fear get lodged in there so deep?
It is due to the fact that they were instilled at a very early age to RE-SPECT authority. The priests, doctors, politicians etc. were created to EXPLOIT YOU!
If you do not re-spect them, they lose that authority and you go on about your life doing what you like to do and you listen to your conscience which is there to help you and they taught you not to and to listen to THEM because they know what is best for you.
So this is where it got you. How do you like where it has brought you....do you like yourself? Do you have peace of mind and feel happy inside and do not take anything to alter yourself?
If you do, its because you have not allowed them to dictate to you and you listen to your conscience.
Those who do not and choose.....CHOOSE to listen to their BS propaganda will go down with the sinking ship and you will continue to keep coming back here to be their slaves....you will continue this until you GET IT.....and when you do, your whole being will cry out for deliverance at the hell you allowed THEM to tell you who and what you are and what will make you happy!
Listen to your conscience folks....this is it......these are those days, make no mistake about it, your very existence depends upon listening to your gut feelings that tell you to stop this nonsense and to stop allowing them to manipulate you and exploit those who are weaker than yourself.
You reap what you sow and those who do not recognize this law of the universe better be prepared for the next stage of existence.....its a choice people.....its simply a CHOICE!!!
mysterynomore

User ID: 14903084
Australia
04/23/2012 09:35 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
There has been a large scale effect of distortion in our frequency fields in the earth's bio-fields.
the wave forms have imitation frequency ranges that overlay earth's natural fields of energy.

This has contrubuted to what has been mentioned about the boom sounds and deaths of animals.

Were all tied into this field through our energy bodies...so are animals.

It's as obvious as the noses on your faces what's occuring.
If you disrupt the earth's fields with imitation frequency's...you disrupt what lives on her body.
Anonymous Coward
User ID: 10644407
United States
04/23/2012 09:39 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Send a few to Aus they are in plague proportions here so much so they blacken the sky in some areas not to mention shitting over everything.
 Quoting: khnum 455005


i found this more scary after i got link to this site :
[link to www.end-times-prophecy.org]
 Quoting: SteppingoutofMatrix


What's going to happen when their food isn't provided by Jesus Christ?

Don't get me wrong, I'm a believer... but part of that belief is knowing that Jesus and God aren't...that... active in our daily lives. They mostly just judge what we do with these situations after we're dead. They're observers.
Anonymous Coward
User ID: 14842010
United States
04/23/2012 09:50 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Send a few to Aus they are in plague proportions here so much so they blacken the sky in some areas not to mention shitting over everything.
 Quoting: khnum 455005


i found this more scary after i got link to this site :
[link to www.end-times-prophecy.org]
 Quoting: SteppingoutofMatrix


please understand though that the animal deaths are NOT a person in the sky named God's warning to the world. IT IS NATURE's warning. the White angels carrying scrolls is a shit interpretation of the incomplete and messed up revelations. I happen to work with those here from "heaven", and they are not busy killing animals to warn man.
Anonymous Coward
User ID: 14842010
United States
04/23/2012 09:53 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Send a few to Aus they are in plague proportions here so much so they blacken the sky in some areas not to mention shitting over everything.
 Quoting: khnum 455005


i found this more scary after i got link to this site :
[link to www.end-times-prophecy.org]
 Quoting: SteppingoutofMatrix


What's going to happen when their food isn't provided by Jesus Christ?

Don't get me wrong, I'm a believer... but part of that belief is knowing that Jesus and God aren't...that... active in our daily lives. They mostly just judge what we do with these situations after we're dead. They're observers.
 Quoting: Charlie the Choo-Choo


you have a ball missing in your "beleifs" too. You are a believer not a knower. Your Father within and your angelic guardians are involved with you.
Anonymous Coward
User ID: 12203402
United States
04/23/2012 09:53 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Send a few to Aus they are in plague proportions here so much so they blacken the sky in some areas not to mention shitting over everything.
 Quoting: khnum 455005


i found this more scary after i got link to this site :
[link to www.end-times-prophecy.org]
 Quoting: SteppingoutofMatrix


We went to a cave last summer and the guide discussed this and had us clean our shoes because of it. They seemed concerned for their bats. Also, I have seen that website. It is a good link. I am happy that people are still tracking the animal mass die offs. I think it is something that should be getting more MSM and general population attention as animals are a good indicator of what is going on with the earth that humans may not be noticing. Animals are more aware and sensitive to changes. Thanks OP for keeping us informed!
Ozark

User ID: 9696387
United States
04/23/2012 09:54 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
sucks..the bugs are already gonna be out of control this summer cause the mild winter. kinda puts the *pest* in pestilence.
 Quoting: Anonymous Coward 1353340


and with bill gates releasing those gmo mosquitos here in florida...break out the SKIN SO SOFT avon oil.
to keep the bugger away.

eucalyptus trees that grow in UR yard will repel mosquitos and other insects.these trees need lots of water to grow.
 Quoting: Anonymous Coward 13944478



And you can put a bat house in your yard, they eat mosquitos and other insects. Then you can sit outside and enjoying watching the bats in the evening!

We have 8-9 different bat species here and a very large population of bats that nest in trees and caves. We put up our first bat house yesterday!!! We have almost no mosquitos, never have to put repellant on.

IMHO, it is GMO's, agricultural spraying, chemtrails and oil related toxins.
Love bats!!!

bat
 Quoting: Ozark


I agree.

A lady that is buying the farm next to me got permission to put her bee hive on the property last year while they had a contract on the property. Any how, the owners that are selling the property told her they wanted to plant corn on it. What she didn't know, is that they planned on no-tilling it (no-till - spraying the ground with a very powerful herbicide then drilling the corn). Her hive did well for a few months there till after the corn was no-tilled. Not long after the ground was no-tilled, the bees began dropping dead in groups and in several weeks ALL bees were dead. The no-till was used approximately 150 feet near the hives at the closest to the hive. So thus the herbicides DO kill bees!!!


too_sad


Ignorance and apathy abounds~~~~

verysad
 Quoting: Pa resident1

Favorite quote or Haiku,
Nikos Kazantzakis

" I said to the Almond tree, "Sister, speak to me of God..."
And the Almond tree blossomed...
Anonymous Coward
User ID: 14842010
United States
04/23/2012 09:54 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
Does anyone have the link to the noises? I want to hear them.

They may be the sounds of trumpets mentioned in the Necronomicon, the Egyptian book of the dead, and there was another book I was reading a long time ago I can't remember the name of the book but the chapter was "How to summon demons" which had a spell in it that stated when the spell is finished the trumpets will call.

Reading them for research.. no I did not call any demons. But I've seen many of them and they do exist. Do I have proof? no.

But I did have a foot print in coffee grinds that were spilled in two sides of the room and the can was standing up on the counter after using a Ouija board.

The footprint was the size of a babies foot with 3 toes.
 Quoting: Doom_Sayer


where have you been, new to here or never noticed? these are all over the place, and are on you tube etc. put trumpets or sounds into search here if it's working today.
Anonymous Coward
User ID: 9090455
United States
04/23/2012 10:05 AM
Report Abusive Post
Report Copyright Violation
Re: 7 million bats die from WNS: ‘We can’t stop this thing and its marching across the country’
[link to www.youtube.com]
Over 7 million bats have been wiped out by a disease (WNS) that is rapidly spreading across the country.
 Quoting: SteppingoutofMatrix


BATMAN!!! WHERE ARE YOU WHEN WE NEED YOU???

REMEMBER THE BAT HOLOCAUST! Construct thousands of Bat Holocaust memorial museums around the world! Establish an international Day of Remembrance! Add a new chapter to the history books! Establish a new Bat country! Outlaw anti-Batism! Add new high paying federal positions to aid in forming US Bat tolerance policies. Force all the governments of the world to make a pledge of NEVER AGAIN to all the bats, and require them to reaffirm that pledge at least annually!





GLP