Provide a useless fact that most people won't know

Users Online Now: 1,863 (Who's On?)	Visitors Today: 1,250,015
Pageviews Today: 1,706,809	Threads Today: 434	Posts Today: 7,207
01:39 PM

Page 1 2 3 4 5 6 7 8 9 10 Bottom Search Replies Previous Page Next Page
Search Terms: Highlight Matches
Provide a useless fact that most people won't know
weasel keeper User ID: 34212927 United States 02/12/2013 10:08 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The fossilised penile bone of a walrus is called "oosic". Wild Weasels? You've got to be shitting me!

what... User ID: 10428886 United States 02/12/2013 10:35 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know 50% of the worlds population... is half the people on earth.
Anonymous Coward User ID: 34284075 Australia 02/12/2013 10:46 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The Vatican created the Islamic religion [link to www.remnantofgod.org]
Anonymous Coward User ID: 13479433 United States 02/12/2013 11:05 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The Royal family has people to wipe their asses when they shit...... sad but true..........
acegotflows User ID: 28872932 United States 02/12/2013 11:06 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my great uncle was one of the first black test pilots in the Army "a foundation built on lies is always bound to crumble and those who aren't humble shall tumble to the earth"
DrKnow User ID: 32604708 Mexico 02/12/2013 11:14 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Twice around your thumb is once around your wrist. Twice around your wrist is once around your neck. Twice around your neck is once around your waist. Even if you are a fucking fat land manatee.
22050hz User ID: 34185994 Canada 02/12/2013 11:18 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know When you throw a pot of boiling water up in the air during wintertime when it's REALLY cold, the boiling water immediately turns into snow.
Matrix-V User ID: 32905635 Canada 02/12/2013 11:23 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Kangaroos cant run backwards
Hard Eight User ID: 8668963 United States 02/12/2013 11:25 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Wrong side of the tracks. Back when steam ran the railroads their coal ash was blown downwind. If you lived downwind for the predominant direction you were from THE WRONG SIDE OF THE TRACKS. Texas has yet to learn submission to any oppression, come from what source it may. Sam Houston "The beauty of the Second Amendment is that it will not be needed until they try to take it." Thomas Jefferson If you don't read the newspaper you are uninformed, if you do read the newspaper you are misinformed. -- Mark Twain Giving money and power to government is like giving whiskey and keys to teenage boys. -- P.J. O'Rourke, Civil Libertarian
JanJan User ID: 18450840 United States 02/12/2013 11:26 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my great uncle was one of the first black test pilots in the Army Quoting: acegotflows Very cool
Anonymous Coward User ID: 27364145 United States 02/12/2013 11:27 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my nuts smell like A-1 sauce

Anonymous Coward User ID: 27364145 United States 02/12/2013 11:27 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know i'm pretty sure that might have broken the mood...
Matrix-V User ID: 32905635 Canada 02/12/2013 11:29 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my great uncle was one of the first black test pilots in the Army Quoting: acegotflows Very cool Quoting: JanJan pics or it didnt happen
Zedakah User ID: 25719696 United States 02/12/2013 11:57 PM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know When you throw a pot of boiling water up in the air during wintertime when it's REALLY cold, the boiling water immediately turns into snow. Quoting: 22050hz Do not try this in Alabama. Really cold is relative here. Michael Crichton listed a Dinosaur DNA sequence on page 103 in his book, Jurassic Park. He made the sequence up from scratch.
Anonymous Coward User ID: 6713570 United States 02/13/2013 12:14 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Ben and Jerry's has a graveyard where they bury all their discontinued ice cream flavors.
Anonymous Coward User ID: 34300737 India 02/13/2013 12:27 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Useless -> Obama The End

Thy Rock User ID: 33344021 United States 02/13/2013 12:51 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know I'll start The London 7/7 bombings happened 911 days after 9/11. Quoting: gashman There is a saying in Zen; 'when the realization is deep, your whole being is dancing." Right!!
Anonymous Coward User ID: 33214007 United States 02/13/2013 12:59 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my blood tastes like pennys
Anonymous Coward User ID: 33214007 United States 02/13/2013 01:00 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know God doesn't know we exist. O.O
Anonymous Coward User ID: 26863066 Canada 02/13/2013 01:04 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know No one ever reads this last post of a thread.
Scully User ID: 13250526 Australia 02/13/2013 01:14 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Afer 40 fair women...blondes/redheads...should shave their whole face (except for the eyebrows) every other day....it exfoliates, reduces wrinkling, gets rid of unwanted facial hair and makeup goes on way easier. Before you throw out your shaver (after you've used it a few times of course) use it to gently remove dead skin on the feet.
Scully User ID: 13250526 Australia 02/13/2013 01:16 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Twice around your thumb is once around your wrist. Twice around your wrist is once around your neck. Twice around your neck is once around your waist. Even if you are a fucking fat land manatee. Quoting: DrKnow 32604708 Not necessarily! Liposuction and tummy tucks can change that.
acegotflows User ID: 28872932 United States 02/13/2013 01:36 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know my great uncle was one of the first black test pilots in the Army Quoting: acegotflows Very cool Quoting: JanJan pics or it didnt happen Quoting: Matrix-V why do you care? Useless facts remember? "a foundation built on lies is always bound to crumble and those who aren't humble shall tumble to the earth"
KungPowMeowMeow User ID: 1996174 United States 02/13/2013 01:43 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know You can't find one single airline flight into Delaware because it is the only state without a commercial airport. "Fortune, honour, beauty, youth are but blossoms dying. Wanton pleasures, doting love are but shadows flying." ---Thomas Campion
Dr. Shlong User ID: 26385742 United States 02/13/2013 02:06 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know Glass is actually a highly viscous liquid. No shit.
Anonymous Coward User ID: 12108080 United States 02/13/2013 02:09 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The giblets inside your Thanksgiving turkey are not from that turkey.

Anonymous Coward User ID: 4547295 United States 02/13/2013 02:12 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The average salinity of human blood world wide is equal to the average salinity of the worlds oceans.
Anonymous Coward User ID: 28678631 Thailand 02/13/2013 02:14 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know What country is Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit in? Quoting: Anonymous Coward 1190661 Its bangkok in thailand
Anonymous Coward User ID: 28678631 Thailand 02/13/2013 02:47 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know The first vertebra to support the head is called ATLAS (after the titan who supported the world on his shoulders) and we are all born with it twisted towards the right (genetic manipulation???) Quoting: queentut I had mine realigned. feels much better. atlas realignment.
Anonymous Coward User ID: 34304944 Australia 02/13/2013 03:02 AM Report Abusive Post Report Copyright Violation	Re: Provide a useless fact that most people won't know What country is Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit in? Quoting: Anonymous Coward 1190661 Its bangkok in thailand Quoting: Anonymous Coward 28678631 so is cometoourbarandbuydrinkswhilewegetunderagegirlstosuckyourdickunderthecounterandladyboysoutthebackroomifyoupreferpleasebesureyouhaveyourhepatitisjabsuptodatesopleasecomtoourbarsoldierboyweloveyoulongtime
Page 1 2 3 4 5 6 7 8 9 10 Top Previous Page Next Page

Related Threads

Join Now, Free! (& No Ads!) Forgot Your Password?
Email	Password	Remember

1	Most of the Federal and State Governments are Nothing But Paper Pusher Parasites and Useless Eaters	04/10/24
2	Every site is boring , and most threads on GLP are boring.. so I click on useless threads like this	03/07/24
3	Some absolutely useless historical facts! But fun to know!	03/12/13
4	External Advisors vs Intuitive Advisors. Some people always give bad advice & useless opinions.	08/05/09
5	A new CDC study provides more proof the 'vaccines' are useless. Covid spreads even in groups where most people are vaccinated	09/21/21
6	UK Medical Association: "Home kits for coronavirus are useless, people are too stupid to know how to use them".	05/01/20
7	If You Cannot Help The Ignorance Useless Eaters, You Better Stop Manage People Doing That Job	05/15/22
8	Some absolutely useless historical facts!	03/10/13
9	6 Body Parts Doctors Think Are Useless: How Little Do They Know	10/03/12
10	Former TSA Agent Comes Clean, ‘Useless’ Scanners Provided Endless Fodder for Employees Read more at http://thefreethoughtproject.com/tsa-agent-cl	02/02/14

Rate this Thread

Provide a useless fact that most people won't know