Provide a useless fact that most people won't know | |
weasel keeper User ID: 34212927 United States 02/12/2013 10:08 PM Report Abusive Post Report Copyright Violation | |
what... User ID: 10428886 United States 02/12/2013 10:35 PM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 34284075 Australia 02/12/2013 10:46 PM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 13479433 United States 02/12/2013 11:05 PM Report Abusive Post Report Copyright Violation | |
acegotflows User ID: 28872932 United States 02/12/2013 11:06 PM Report Abusive Post Report Copyright Violation | |
DrKnow User ID: 32604708 Mexico 02/12/2013 11:14 PM Report Abusive Post Report Copyright Violation | |
22050hz User ID: 34185994 Canada 02/12/2013 11:18 PM Report Abusive Post Report Copyright Violation | |
Matrix-V User ID: 32905635 Canada 02/12/2013 11:23 PM Report Abusive Post Report Copyright Violation | |
Hard Eight User ID: 8668963 United States 02/12/2013 11:25 PM Report Abusive Post Report Copyright Violation | Wrong side of the tracks. Back when steam ran the railroads their coal ash was blown downwind. If you lived downwind for the predominant direction you were from THE WRONG SIDE OF THE TRACKS. Texas has yet to learn submission to any oppression, come from what source it may. Sam Houston "The beauty of the Second Amendment is that it will not be needed until they try to take it." Thomas Jefferson If you don't read the newspaper you are uninformed, if you do read the newspaper you are misinformed. -- Mark Twain Giving money and power to government is like giving whiskey and keys to teenage boys. -- P.J. O'Rourke, Civil Libertarian |
JanJan User ID: 18450840 United States 02/12/2013 11:26 PM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 27364145 United States 02/12/2013 11:27 PM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 27364145 United States 02/12/2013 11:27 PM Report Abusive Post Report Copyright Violation | |
Matrix-V User ID: 32905635 Canada 02/12/2013 11:29 PM Report Abusive Post Report Copyright Violation | |
Zedakah User ID: 25719696 United States 02/12/2013 11:57 PM Report Abusive Post Report Copyright Violation | When you throw a pot of boiling water up in the air during wintertime when it's REALLY cold, the boiling water immediately turns into snow. Quoting: 22050hz Do not try this in Alabama. Really cold is relative here. Michael Crichton listed a Dinosaur DNA sequence on page 103 in his book, Jurassic Park. He made the sequence up from scratch. |
Anonymous Coward User ID: 6713570 United States 02/13/2013 12:14 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 34300737 India 02/13/2013 12:27 AM Report Abusive Post Report Copyright Violation | |
Thy Rock User ID: 33344021 United States 02/13/2013 12:51 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 33214007 United States 02/13/2013 12:59 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 33214007 United States 02/13/2013 01:00 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 26863066 Canada 02/13/2013 01:04 AM Report Abusive Post Report Copyright Violation | |
Scully User ID: 13250526 Australia 02/13/2013 01:14 AM Report Abusive Post Report Copyright Violation | Before you throw out your shaver (after you've used it a few times of course) use it to gently remove dead skin on the feet. |
Scully User ID: 13250526 Australia 02/13/2013 01:16 AM Report Abusive Post Report Copyright Violation | |
acegotflows User ID: 28872932 United States 02/13/2013 01:36 AM Report Abusive Post Report Copyright Violation | |
KungPowMeowMeow User ID: 1996174 United States 02/13/2013 01:43 AM Report Abusive Post Report Copyright Violation | |
Dr. Shlong User ID: 26385742 United States 02/13/2013 02:06 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 12108080 United States 02/13/2013 02:09 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 4547295 United States 02/13/2013 02:12 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 28678631 Thailand 02/13/2013 02:14 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 28678631 Thailand 02/13/2013 02:47 AM Report Abusive Post Report Copyright Violation | |
Anonymous Coward User ID: 34304944 Australia 02/13/2013 03:02 AM Report Abusive Post Report Copyright Violation | What country is Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit in? Quoting: Anonymous Coward 1190661 Its bangkok in thailand so is cometoourbarandbuydrinkswhilewegetunderagegirlstosuckyourdickunderthecounterandladyboysoutthebackroomifyoupreferpleasebesureyouhaveyourhepatitisjabsuptodatesopleasecomtoourbarsoldierboyweloveyoulongtime |